PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00351.90
Common NameJCGZ_19845, LOC105644064
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family ZF-HD
Protein Properties Length: 98aa    MW: 10651.8 Da    PI: 8.0518
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00351.90genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer105.92.4e-332783360
    ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                   +v+Y eC+kNhAa++Gg+avDGC+Efm+s geegt+ al+CaACgCHRnFHRreve+e
  Jcr4S00351.90 27 SVKYGECQKNHAANVGGYAVDGCREFMAS-GEEGTSLALTCAACGCHRNFHRREVETE 83
                   689*************************9.999*********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047708.9E-312880IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257746.0E-272993IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.3E-272980IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.8723079IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 98 aa     Download sequence    Send to blast
MRKRQVVVRR TEEPSRSSST SSFTIRSVKY GECQKNHAAN VGGYAVDGCR EFMASGEEGT  60
SLALTCAACG CHRNFHRREV ETELVCDCSS PTSNGNGT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012084701.14e-67PREDICTED: mini zinc finger protein 2
SwissprotQ9LJW54e-45MIF2_ARATH; Mini zinc finger protein 2
TrEMBLA0A067JT595e-67A0A067JT59_JATCU; Uncharacterized protein
STRINGPOPTR_0004s12510.12e-56(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF155034100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.17e-39mini zinc finger 2
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]